HNF4A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004712

 

Antibody CAB019417

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA004712 3113 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

105  

Antigen sequence

LLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMC
EWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTI
TKQEV
 
 

Matching transcripts

HNF4A-001 - ENSP00000315180 [100%]
HNF4A-002 - ENSP00000312987 [100%]
HNF4A-005 - ENSP00000396216 [90%]
HNF4A-006 - ENSP00000412111 [90%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human liver shows distinct positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400161)
More information
  

Target mass (kDa)

52.8, 51.6, 50.1, 49.0 52.8, 51.6, 50.1, 49.0, 46.6, 44.0, 12.0, 11.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HNF4A-001
 
HNF4A-002
 
HNF4A-005
 
HNF4A-006