EMD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000609

 

Antibody CAB001545

 

Antibody CAB002029

 

Antibody CAB062552

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Novocastra
 Atlas Antibodies
 

Product name

HPA000609 SC-15378 NCL-EMERIN AMAb90560 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Not known Protein A/G 

Released in version

1 1 1 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Not known Recombinant protein 

Length (aa)

112    

Antigen sequence

ASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTY
GEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMY
GRDSACQSITHY
 
 
 
 

Matching transcripts

EMD-001 - ENSP00000358857 [99%]
EMD-010 - ENSP00000358850 [93%]
    

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human skeletal muscle shows moderate nuclear membrane positivity in myocytes.
More information
 Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human kidney shows distinct of nuclear membranes positivity in renal cells.
More information
 Immunohistochemical staining of human testis shows nuclear and membranous positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:2000 1:80 1:5000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nuclear membrane & endoplasmic reticulum.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nuclear membrane & endoplasmic reticulum.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nuclear membrane.
More information
  

Antibody dilution

1:100 1:2000 1:20  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

29.0, 24.9 29.0, 24.9, 2.4 29.0, 24.9, 2.4 29.0, 24.9, 2.4 

Antibody dilution

1:500 1:500 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
    

Antibody dilution

1:1000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
EMD-001
 
EMD-010