ARHGEF7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004744

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004744 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

135 

Antigen sequence

RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQD
LQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAP
LTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
 

Matching transcripts

ARHGEF7-001 - ENSP00000218789 [100%]
ARHGEF7-004 - ENSP00000397068 [100%]
ARHGEF7-005 - ENSP00000364875 [100%]
ARHGEF7-007 - ENSP00000364888 [100%]
ARHGEF7-008 - ENSP00000325994 [100%]
ARHGEF7-011 - ENSP00000417596 [100%]
ARHGEF7-201 - ENSP00000359657 [100%]
ARHGEF7-202 - ENSP00000364889 [100%]
ARHGEF7-203 - ENSP00000364891 [100%]
ARHGEF7-204 - ENSP00000364893 [100%]
ARHGEF7-013 - ENSP00000418067 [81%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

90.0, 87.8, 84.5, 82.6, 81.4, 79.8, 73.1, 70.4, 61.6, 50.5 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ARHGEF7-001
 
ARHGEF7-004
 
ARHGEF7-005
 
ARHGEF7-007
 
ARHGEF7-008
 
ARHGEF7-011
 
ARHGEF7-013
 
ARHGEF7-201
 
ARHGEF7-202
 
ARHGEF7-203
 
ARHGEF7-204
 
 »