ABCC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002380

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002380 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

142 

Antigen sequence

LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTE
QEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGD
ISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD
 

Matching transcripts

ABCC1-001 - ENSP00000382342 [100%]
ABCC1-201 - ENSP00000263014 [100%]
ABCC1-202 - ENSP00000263019 [100%]
ABCC1-203 - ENSP00000263016 [100%]
ABCC1-204 - ENSP00000263017 [100%]
ABCC1-007 - ENSP00000461615 [93%]
ABCC1-205 - ENSP00000382340 [93%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in a subset of cells in glomeruli.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
More information
 

Antibody dilution

1:24 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

172.6, 171.6, 165.6, 165.0, 164.3, 160.4, 158.9 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABCC1-001
 
ABCC1-007
 
ABCC1-201
 
ABCC1-202
 
ABCC1-203
 
ABCC1-204
 
ABCC1-205