HMOX2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040611

 

Antibody CAB025464

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA040611 MAB3170 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

9 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

64  

Antigen sequence

MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKY
VERIHYIGQNEPEL
 
 

Matching transcripts

HMOX2-001 - ENSP00000459214 [100%]
HMOX2-002 - ENSP00000394103 [100%]
HMOX2-003 - ENSP00000381595 [100%]
HMOX2-004 - ENSP00000219700 [100%]
HMOX2-005 - ENSP00000458797 [100%]
HMOX2-006 - ENSP00000460926 [100%]
HMOX2-011 - ENSP00000458592 [100%]
HMOX2-201 - ENSP00000385100 [100%]
HMOX2-202 - ENSP00000391637 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:75 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & vesicles.
More information
 

Antibody dilution

 1:19 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.0, 32.8, 27.7, 26.6 36.0, 32.8, 27.7, 26.6, 15.3, 15.2, 12.8, 12.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HMOX2-001
 
HMOX2-002
 
HMOX2-003
 
HMOX2-004
 
HMOX2-005
 
HMOX2-006
 
HMOX2-011
 
HMOX2-201
 
HMOX2-202