RPGRIP1L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039405

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039405 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

115 

Antigen sequence

KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIP
NFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAP
KTAQLSSTDSTDGNL
 

Matching transcripts

RPGRIP1L-001 - ENSP00000456534 [100%]
RPGRIP1L-003 - ENSP00000262135 [100%]
RPGRIP1L-007 - ENSP00000457889 [100%]
RPGRIP1L-009 - ENSP00000369257 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

151.2, 147.3, 144.8, 142.8 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RPGRIP1L-001
 
RPGRIP1L-003
 
RPGRIP1L-007
 
RPGRIP1L-009