RNF40

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041330

 

Antibody HPA054227

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041330 HPA054227 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 57 

Antigen sequence

AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRL
QDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
 
GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELRERE
GPSLGPP
 

Matching transcripts

RNF40-001 - ENSP00000325677 [100%]
RNF40-009 - ENSP00000350563 [100%]
RNF40-010 - ENSP00000456538 [100%]
RNF40-011 - ENSP00000455180 [100%]
 RNF40-001 - ENSP00000325677 [98%]
RNF40-009 - ENSP00000350563 [98%]
RNF40-011 - ENSP00000455180 [98%]
RNF40-201 - ENSP00000384942 [98%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and Leydig cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:700  

Literature conformity

Consistent with gene/protein characterization data  

RNA consistency

Mainly not consistent with RNAseq data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

113.6, 109.0, 102.0, 20.0 113.6, 109.0, 102.0, 79.0 

Antibody dilution

1:250 1:520 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:4150 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:104 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
RNF40-001
 
RNF40-009
 
RNF40-010
 
RNF40-011
 
RNF40-201