CD276

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA009285

 

Antibody HPA017139

 

Antibody CAB017826

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA009285 HPA017139 2622.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

100 101  

Antigen sequence

YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVT
TSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
 
EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSF
AEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDF
G
 
 

Matching transcripts

CD276-001 - ENSP00000454940 [100%]
CD276-002 - ENSP00000320084 [100%]
CD276-003 - ENSP00000452736 [100%]
CD276-007 - ENSP00000441087 [100%]
CD276-201 - ENSP00000320058 [100%]
CD276-012 - ENSP00000453014 [97%]
CD276-008 - ENSP00000453842 [94%]
 CD276-001 - ENSP00000454940 [100%]
CD276-002 - ENSP00000320084 [100%]
CD276-003 - ENSP00000452736 [100%]
CD276-014 - ENSP00000453907 [100%]
CD276-015 - ENSP00000452669 [100%]
CD276-016 - ENSP00000453336 [100%]
CD276-018 - ENSP00000455366 [100%]
CD276-021 - ENSP00000452649 [100%]
CD276-201 - ENSP00000320058 [100%]
CD276-007 - ENSP00000441087 [97%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human prostate shows strong membrane and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:15 1:25 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-251MG shows no positivity.
More information
 

Antibody dilution

1:15 1:11 1:200 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410803)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410803)
More information
  

Target mass (kDa)

57.2, 41.8, 33.8, 21.3, 18.2 57.2, 41.8, 33.8, 17.6, 16.7, 14.5, 14.2 57.2, 41.8, 33.8, 21.3, 18.2, 17.6, 16.7, 15.7, 14.5, 14.2, 5.2, 4.0 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
CD276-001
 
CD276-002
 
CD276-003
 
CD276-007
 
CD276-008
 
CD276-012
 
CD276-014
 
CD276-015
 
CD276-016
 
CD276-018
 
CD276-021
 
CD276-201
 
 »