ASAH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005468

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005468 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

124 

Antigen sequence

ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYEL
DAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDV
LSTKPVLNKLTVYTTLIDVTKGQF
 

Matching transcripts

ASAH1-001 - ENSP00000262097 [100%]
ASAH1-002 - ENSP00000371152 [100%]
ASAH1-003 - ENSP00000326970 [100%]
ASAH1-004 - ENSP00000427751 [100%]
ASAH1-201 - ENSP00000394125 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human epididymis shows strong granular positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.5, 44.7, 44.0, 41.8, 34.6 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ASAH1-001
 
ASAH1-002
 
ASAH1-003
 
ASAH1-004
 
ASAH1-201