GPI

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024305

 

Antibody CAB018655

 

Antibody CAB040563

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 NCI-CPTC
 

Product name

HPA024305 sc-33777 CPTC-GPI-1 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

5 5 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

90   

Antigen sequence

LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVD
HQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
 
 
 

Matching transcripts

GPI-001 - ENSP00000405573 [100%]
GPI-002 - ENSP00000465858 [100%]
GPI-006 - ENSP00000348877 [100%]
GPI-012 - ENSP00000467670 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.
More information
 Immunohistochemical staining of human stomach shows distinct nuclear, cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:125 1:50000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.8, 64.3, 63.1, 53.4 64.8, 64.3, 63.1, 53.4, 19.2, 18.7, 18.6, 18.3, 16.8, 15.4, 12.7, 1.2 64.8, 64.3, 63.1, 53.4, 19.2, 18.7, 18.6, 18.3, 16.8, 15.4, 12.7, 1.2 

Antibody dilution

1:250 1:500 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.
More information
  Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:10  1:400 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
GPI-001
 
GPI-002
 
GPI-006
 
GPI-012