SLC1A5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035239

 

Antibody HPA035240

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035239 HPA035240 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

52 56 

Antigen sequence

MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLR
AN
 
VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVAS
EKESVM
 

Matching transcripts

SLC1A5-001 - ENSP00000444408 [100%]
 SLC1A5-001 - ENSP00000444408 [100%]
SLC1A5-003 - ENSP00000469265 [100%]
SLC1A5-004 - ENSP00000406532 [100%]
SLC1A5-005 - ENSP00000397924 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:200 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & golgi apparatus.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & golgi apparatus.
More information
 

Antibody dilution

1:32 1:102 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417160)
More information
  

Target mass (kDa)

56.6 56.6, 39.4, 36.6, 33.7 

Antibody dilution

1:125 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:30000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SLC1A5-001
 
SLC1A5-003
 
SLC1A5-004
 
SLC1A5-005