OGDH

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019514

 

Antibody HPA020347

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019514 HPA020347 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

69 67 

Antigen sequence

LRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGT
SSNYVEEMYCAWLENPKSV
 
FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLA
VQSLIRAYQIRGHHVAQ
 

Matching transcripts

OGDH-001 - ENSP00000222673 [100%]
OGDH-002 - ENSP00000392878 [100%]
OGDH-003 - ENSP00000388183 [100%]
OGDH-005 - ENSP00000398576 [100%]
OGDH-006 - ENSP00000414662 [100%]
OGDH-007 - ENSP00000388084 [100%]
OGDH-008 - ENSP00000411830 [100%]
 OGDH-001 - ENSP00000222673 [100%]
OGDH-006 - ENSP00000414662 [100%]
OGDH-007 - ENSP00000388084 [100%]
OGDH-008 - ENSP00000411830 [100%]
OGDH-002 - ENSP00000392878 [96%]
OGDH-003 - ENSP00000388183 [96%]
OGDH-201 - ENSP00000443821 [96%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:135 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria.
More information
 

Antibody dilution

1:57 1:100 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

117.7, 117.2, 115.9, 115.5, 99.0, 48.2, 23.2 117.7, 117.2, 115.9, 115.5, 110.6, 48.2, 23.2 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
OGDH-001
 
OGDH-002
 
OGDH-003
 
OGDH-005
 
OGDH-006
 
OGDH-007
 
OGDH-008
 
OGDH-201