CDK5RAP3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022141

 

Antibody HPA022882

 

Antibody HPA027883

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA022141 HPA022882 HPA027883 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

99 93 115 

Antigen sequence

LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQK
QQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
 
ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESP
TEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
 
GDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVAL
QITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAV
ELSEEADVLSVSQFQ
 

Matching transcripts

CDK5RAP3-001 - ENSP00000344683 [100%]
CDK5RAP3-010 - ENSP00000438886 [100%]
CDK5RAP3-033 - ENSP00000464286 [88%]
 CDK5RAP3-001 - ENSP00000344683 [100%]
CDK5RAP3-010 - ENSP00000438886 [100%]
CDK5RAP3-037 - ENSP00000463950 [95%]
 CDK5RAP3-001 - ENSP00000344683 [100%]
CDK5RAP3-010 - ENSP00000438886 [100%]
CDK5RAP3-033 - ENSP00000464286 [99%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:600 1:150 1:1700 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 

Antibody dilution

1:100 1:100 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.6, 56.9, 30.1 59.6, 56.9, 32.0 59.6, 56.9, 30.1 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CDK5RAP3-001
 
CDK5RAP3-010
 
CDK5RAP3-033
 
CDK5RAP3-037