EFTUD2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022021

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA022021 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

111 

Antigen sequence

DDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISV
ARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNT
TSVIKIAVEPV
 

Matching transcripts

EFTUD2-002 - ENSP00000392094 [100%]
EFTUD2-003 - ENSP00000465058 [100%]
EFTUD2-004 - ENSP00000385873 [100%]
EFTUD2-006 - ENSP00000467805 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:7 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

109.4, 108.3, 105.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
EFTUD2-002
 
EFTUD2-003
 
EFTUD2-004
 
EFTUD2-006