SLC9A3R1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA009672

 

Antibody HPA027247

 

Antibody CAB001962

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA009672 HPA027247 07-130 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 6 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

108 137  

Antigen sequence

GENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRA
QEAPGQAEPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSG
YGFNLHSD
 
GGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSRE
ALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPIL
DFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
 
 

Matching transcripts

SLC9A3R1-001 - ENSP00000262613 [100%]
SLC9A3R1-006 - ENSP00000464321 [80%]
 SLC9A3R1-001 - ENSP00000262613 [100%]
SLC9A3R1-002 - ENSP00000464982 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 Immunohistochemical staining of human kidney shows distinct cytoplasmic and membranous positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:3000 1:600 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Mainly consistent with RNAseq data Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401364)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401364)
More information
  

Target mass (kDa)

38.9, 22.9 38.9, 22.0 38.9, 22.9, 22.0, 3.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & centrosome.
More information
 Application not done for this antibody. 

Antibody dilution

1:80 1:100  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:30000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SLC9A3R1-001
 
SLC9A3R1-002
 
SLC9A3R1-006