ALDOC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003282

 

Antibody CAB020828

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA003282 3291.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

78  

Antigen sequence

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
NTEENRRLYRQVLFSADDRVKKCIGGVI
 
 

Matching transcripts

ALDOC-001 - ENSP00000226253 [100%]
ALDOC-002 - ENSP00000378729 [100%]
ALDOC-003 - ENSP00000378731 [100%]
ALDOC-004 - ENSP00000398976 [100%]
ALDOC-005 - ENSP00000463174 [100%]
ALDOC-006 - ENSP00000462674 [100%]
ALDOC-007 - ENSP00000463118 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human hippocampus shows strong positivity in subsets of glial cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:2000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus, nucleoli & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:25  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.5, 36.3, 19.7, 19.1, 16.3, 13.3 39.5, 36.3, 19.7, 19.1, 16.3, 15.0, 13.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ALDOC-001
 
ALDOC-002
 
ALDOC-003
 
ALDOC-004
 
ALDOC-005
 
ALDOC-006
 
ALDOC-007