INPP4B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037681

 

Antibody HPA037682

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037681 HPA037682 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 94 

Antigen sequence

ERRNTGYQFIYYSPENTAKAKEVLSNINQLQPLIATHADLLLNSASQHSP
DSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTA
 
QDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNN
DGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
 

Matching transcripts

INPP4B-001 - ENSP00000425487 [100%]
INPP4B-002 - ENSP00000422793 [100%]
INPP4B-004 - ENSP00000426207 [100%]
INPP4B-005 - ENSP00000421065 [100%]
INPP4B-006 - ENSP00000427250 [100%]
INPP4B-007 - ENSP00000423954 [100%]
INPP4B-201 - ENSP00000262992 [100%]
INPP4B-202 - ENSP00000308441 [100%]
 INPP4B-001 - ENSP00000425487 [100%]
INPP4B-002 - ENSP00000422793 [100%]
INPP4B-004 - ENSP00000426207 [100%]
INPP4B-005 - ENSP00000421065 [100%]
INPP4B-006 - ENSP00000427250 [100%]
INPP4B-007 - ENSP00000423954 [100%]
INPP4B-201 - ENSP00000262992 [100%]
INPP4B-202 - ENSP00000308441 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:20 1:125 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

106.0, 104.7, 92.1, 78.2, 77.5 106.0, 104.7, 92.1, 78.2, 77.5 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in centrosome.
More information
 

Antibody dilution

 1:78 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
INPP4B-001
 
INPP4B-002
 
INPP4B-004
 
INPP4B-005
 
INPP4B-006
 
INPP4B-007
 
INPP4B-201
 
INPP4B-202