CD81

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007234

 

Antibody CAB002507

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA007234 NCL-CD81 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

91  

Antigen sequence

VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLT
ALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
 
 

Matching transcripts

CD81-001 - ENSP00000263645 [100%]
CD81-003 - ENSP00000437242 [100%]
CD81-005 - ENSP00000370424 [100%]
CD81-006 - ENSP00000432249 [100%]
CD81-007 - ENSP00000432033 [100%]
CD81-014 - ENSP00000433767 [100%]
CD81-015 - ENSP00000433904 [100%]
CD81-017 - ENSP00000431780 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic and/or membranous positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:20 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
More information
 

Antibody dilution

1:15 1:40 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

29.8, 25.9, 25.8, 24.4, 23.7, 22.5, 18.0 29.8, 25.9, 25.8, 24.4, 23.7, 22.5, 18.0, 16.0, 10.7, 10.1, 5.7 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
CD81-001
 
CD81-003
 
CD81-005
 
CD81-006
 
CD81-007
 
CD81-014
 
CD81-015
 
CD81-017