SLC11A2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA032139

 

Antibody HPA032140

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA032139 HPA032140 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

41 34 

Antigen sequence

QCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR
 
TNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKG
 

Matching transcripts

SLC11A2-004 - ENSP00000449008 [100%]
SLC11A2-006 - ENSP00000262051 [100%]
SLC11A2-007 - ENSP00000446769 [100%]
SLC11A2-024 - ENSP00000450227 [100%]
 SLC11A2-001 - ENSP00000449200 [100%]
SLC11A2-002 - ENSP00000262052 [100%]
SLC11A2-003 - ENSP00000446914 [100%]
SLC11A2-004 - ENSP00000449008 [100%]
SLC11A2-005 - ENSP00000444542 [100%]
SLC11A2-006 - ENSP00000262051 [100%]
SLC11A2-007 - ENSP00000446769 [100%]
SLC11A2-008 - ENSP00000442810 [100%]
SLC11A2-201 - ENSP00000378364 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic and membranous positivity in pancreatic ducts.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:20 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

  

Target mass (kDa)

62.3, 13.7 64.7, 62.3, 61.5, 61.0, 52.8 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC11A2-001
 
SLC11A2-002
 
SLC11A2-003
 
SLC11A2-004
 
SLC11A2-005
 
SLC11A2-006
 
SLC11A2-007
 
SLC11A2-008
 
SLC11A2-024
 
SLC11A2-201