ENO2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA068284

 

Antibody CAB000063

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA068284 M0873 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

62  

Antigen sequence

QACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERL
AKYNQLMRIEEE
 
 

Matching transcripts

ENO2-001 - ENSP00000438873 [100%]
ENO2-002 - ENSP00000437402 [100%]
ENO2-003 - ENSP00000441490 [100%]
ENO2-004 - ENSP00000438062 [100%]
ENO2-201 - ENSP00000229277 [100%]
ENO2-202 - ENSP00000446195 [100%]
  

Other gene match

ENO1 - ENSG00000074800 [97%]
ENO3 - ENSG00000108515 [97%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells, neuropil was distinctly stained.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 None 

Antibody dilution

1:800 1:200 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.3, 47.2, 47.0, 42.7, 42.2, 34.8 47.3, 42.7, 34.8, 11.2, 9.4, 8.1 

Antibody dilution

1:220 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ENO2-001
 
ENO2-002
 
ENO2-003
 
ENO2-004
 
ENO2-201
 
ENO2-202