DSE

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014764

 

Antibody HPA052151

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA014764 HPA052151 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

132 133 

Antigen sequence

FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFV
DAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEK
HKNGGLIKGRFGQARMVTTTHSRAPSLSASYT
 
MYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFI
GPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIAD
RHKILFDRNSAIKSSIVPEVKDYAAIVEQNLQH
 

Matching transcripts

DSE-002 - ENSP00000332151 [100%]
DSE-003 - ENSP00000404049 [100%]
DSE-201 - ENSP00000352567 [100%]
DSE-202 - ENSP00000441152 [100%]
 DSE-002 - ENSP00000332151 [100%]
DSE-003 - ENSP00000404049 [100%]
DSE-201 - ENSP00000352567 [100%]
DSE-202 - ENSP00000441152 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells and islet cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:350  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:74 1:81 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

111.8, 109.8 111.8, 109.8 

Antibody dilution

1:250 1:410 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3250 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
DSE-002
 
DSE-003
 
DSE-201
 
DSE-202