HBS1L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029728

 

Antibody HPA029729

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029728 HPA029729 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 96 

Antigen sequence

CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLT
LVGMDIIKINVGCIFCGPKVPIKACTRF
 
RNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVE
EYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEI
 

Matching transcripts

HBS1L-001 - ENSP00000356811 [100%]
HBS1L-006 - ENSP00000356800 [100%]
HBS1L-007 - ENSP00000389826 [100%]
HBS1L-009 - ENSP00000434533 [100%]
HBS1L-010 - ENSP00000436256 [100%]
HBS1L-201 - ENSP00000356798 [100%]
HBS1L-202 - ENSP00000415305 [100%]
 HBS1L-001 - ENSP00000356811 [100%]
HBS1L-003 - ENSP00000323566 [100%]
HBS1L-004 - ENSP00000356796 [100%]
HBS1L-014 - ENSP00000356794 [100%]
HBS1L-011 - ENSP00000433030 [90%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows distinct membranous positivity in proximal tubules.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:20 1:300 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:50 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.5, 70.6, 68.3, 60.6, 57.0, 45.1 75.5, 70.1, 24.2, 19.2, 16.7 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
HBS1L-001
 
HBS1L-003
 
HBS1L-004
 
HBS1L-006
 
HBS1L-007
 
HBS1L-009
 
HBS1L-010
 
HBS1L-011
 
HBS1L-014
 
HBS1L-201
 
HBS1L-202
 
 »