APBB3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005571

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005571 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

116 

Antigen sequence

AIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQR
PTWELGDAEDPGTGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESY
IQSMEPGAKCFAVRSL
 

Matching transcripts

APBB3-001 - ENSP00000349177 [100%]
APBB3-002 - ENSP00000346378 [100%]
APBB3-003 - ENSP00000350171 [100%]
APBB3-004 - ENSP00000422718 [100%]
APBB3-005 - ENSP00000426107 [100%]
APBB3-011 - ENSP00000402591 [100%]
APBB3-012 - ENSP00000424317 [100%]
APBB3-201 - ENSP00000351389 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:60 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & actin filaments.
More information
 

Antibody dilution

1:167 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.2, 53.0, 52.6, 52.3, 37.2, 36.9, 26.5, 23.6 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
APBB3-001
 
APBB3-002
 
APBB3-003
 
APBB3-004
 
APBB3-005
 
APBB3-011
 
APBB3-012
 
APBB3-201