NR3C1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004248

 

Antibody CAB010435

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA004248 sc-8992 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

148  

Antigen sequence

DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVA
SQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGND
LGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
 
 

Matching transcripts

NR3C1-001 - ENSP00000231509 [100%]
NR3C1-002 - ENSP00000377977 [100%]
NR3C1-003 - ENSP00000387672 [100%]
NR3C1-006 - ENSP00000377979 [100%]
NR3C1-007 - ENSP00000427672 [100%]
NR3C1-010 - ENSP00000422518 [100%]
NR3C1-201 - ENSP00000343205 [100%]
NR3C1-203 - ENSP00000405282 [100%]
NR3C1-004 - ENSP00000424747 [97%]
NR3C1-005 - ENSP00000425313 [97%]
NR3C1-008 - ENSP00000420856 [97%]
NR3C1-009 - ENSP00000426478 [97%]
NR3C1-013 - ENSP00000425374 [97%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
More information
 Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm, mitochondria & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:14 1:13 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424874)
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.8, 85.7, 82.9, 81.5, 15.4, 15.3 85.8, 85.7, 82.9, 81.5, 43.1, 15.4, 15.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
NR3C1-001
 
NR3C1-002
 
NR3C1-003
 
NR3C1-004
 
NR3C1-005
 
NR3C1-006
 
NR3C1-007
 
NR3C1-008
 
NR3C1-009
 
NR3C1-010
 
NR3C1-013
 
NR3C1-201
 
NR3C1-203
 
 »