ABHD14A-ACY1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036174

 

Antibody HPA036175

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036174 HPA036175 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

79 86 

Antigen sequence

QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTG
RPGHASRFMEDTAAEKLHKVVNSILAFRE
 
SVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQA
AGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCK
 

Matching transcripts

ABHD14A-ACY1-001 - ENSP00000420487 [100%]
 ABHD14A-ACY1-001 - ENSP00000420487 [100%]
 

Other gene match

ACY1 - ENSG00000243989 [100%]
 ACY1 - ENSG00000243989 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in renal tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subsets of renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:350 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 1:5 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

56.4, 56.0, 45.9, 42.2, 38.6, 25.8 56.4, 56.0, 45.9, 42.2, 37.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABHD14A-ACY1-001