ACY1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036174

 

Antibody HPA036175

 

Antibody CAB003695

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA036174 HPA036175 H00000095-M01 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

10 10 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

79 86  

Antigen sequence

QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTG
RPGHASRFMEDTAAEKLHKVVNSILAFRE
 
SVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQA
AGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCK
 
 

Matching transcripts

ACY1-001 - ENSP00000384296 [100%]
ACY1-007 - ENSP00000417056 [100%]
ACY1-201 - ENSP00000390557 [100%]
ACY1-006 - ENSP00000419262 [85%]
ACY1-011 - ENSP00000419830 [85%]
 ACY1-001 - ENSP00000384296 [100%]
ACY1-007 - ENSP00000417056 [100%]
ACY1-008 - ENSP00000417618 [100%]
ACY1-201 - ENSP00000390557 [100%]
  

Other gene match

ABHD14A-ACY1 - ENSG00000114786 [100%]
 ABHD14A-ACY1 - ENSG00000114786 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in renal tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subsets of renal tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:350 1:500 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows no positivity.
More information
 

Antibody dilution

1:200 1:5 1:125 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

56.4, 56.0, 45.9, 42.2, 38.6, 25.8 56.4, 56.0, 45.9, 42.2, 37.6 56.0, 45.9, 42.2, 38.6, 37.6, 25.8, 22.7 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACY1-001
 
ACY1-006
 
ACY1-007
 
ACY1-008
 
ACY1-011
 
ACY1-201