PRDX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007730

 

Antibody CAB004682

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA007730 H00005052-M02 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

125  

Antigen sequence

KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCH
LAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIID
DKGILRQITVNDLPVGRSVDETLRL
 
 

Matching transcripts

PRDX1-001 - ENSP00000361152 [100%]
PRDX1-002 - ENSP00000407034 [100%]
PRDX1-004 - ENSP00000389047 [100%]
PRDX1-201 - ENSP00000262746 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:500 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

22.1, 19.0 22.1, 19.0, 10.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Application not done for this antibody. 

Antibody dilution

1:10  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRDX1-001
 
PRDX1-002
 
PRDX1-004
 
PRDX1-201