XPNPEP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000339

 

Antibody CAB025136

 

Antibody CAB025269

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 R&D systems
 

Product name

HPA000339 MAB2490 MAB24901 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

5 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

111   

Antigen sequence

VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSS
IRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRI
WIGTSYTMYGI
 
 
 

Matching transcripts

XPNPEP2-001 - ENSP00000360147 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows distinct membranous positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and luminal membrane positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in tublar cells.
More information
 

Retrieval method

HIER pH9 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:550 1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

75.6 75.6, 20.4 75.6, 20.4 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:1000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
XPNPEP2-001