F13A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001804

 

Antibody HPA047903

 

Antibody CAB002155

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA001804 HPA047903 NCL-FXIIIa 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

136 36  

Antigen sequence

LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDP
RRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRL
SIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
 
SETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVP
 
 

Matching transcripts

F13A1-001 - ENSP00000264870 [100%]
 F13A1-001 - ENSP00000264870 [100%]
F13A1-003 - ENSP00000413334 [100%]
F13A1-004 - ENSP00000416295 [100%]
F13A1-006 - ENSP00000411114 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human corpus, uterine, shows strong cytoplasmic and nuclear positivity in a subset of cells in endometrial stroma.
More information
 Application not done for this antibody. Immunohistochemical staining of human vulva/anal skin shows cytoplasmic and nuclear positivity in a subset of cells in dermis.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:150  1:80 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, focal adhesion sites & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in actin filaments.
More information
 Application not done for this antibody. 

Antibody dilution

1:32 1:35  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.3 83.3, 21.0, 16.7, 16.0 83.3, 21.0, 16.7, 16.0, 11.2 

Antibody dilution

1:250 1:170 1:5000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:1400  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
F13A1-001
 
F13A1-003
 
F13A1-004
 
F13A1-006