SOX9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001758

 

Antibody CAB022456

 

Antibody CAB068240

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 Atlas Antibodies
 

Product name

HPA001758 AB5535 AMAb90795 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

2 5 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

117   

Antigen sequence

SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYD
YTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQ
THSPQHWEQPVYTQLTR
 
 
 

Matching transcripts

SOX9-001 - ENSP00000245479 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows distinct nuclear positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human salivary gland shows strong nuclear positivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:125 1:1000 1:1250 

Literature conformity

Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:20 1:125  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         siRNA

Image

   

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:10   

Validation siRNA

Supportive: The siRNA validation is supportive.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424779)
More information
   

Target mass (kDa)

56.1 56.1 56.1 

Antibody dilution

1:250 1:500 1:1000 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:2000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
SOX9-001