DACH2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000258

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000258 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

119 

Antigen sequence

ITAAAMAEAMKLQKMKLMAMNTLQGNGSQNGTESEPDDLNSNTGGSESSW
DKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHLLTNRLDL
PFMMMPHPLLPVSLPPASV
 

Matching transcripts

DACH2-001 - ENSP00000362223 [100%]
DACH2-003 - ENSP00000421509 [100%]
DACH2-006 - ENSP00000420896 [100%]
DACH2-007 - ENSP00000362217 [100%]
DACH2-002 - ENSP00000421919 [96%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows distinct nuclear positivity in cerebellar tissue.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

65.3, 61.9, 47.3, 47.2, 41.8 

Antibody dilution

1:500 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DACH2-001
 
DACH2-002
 
DACH2-003
 
DACH2-006
 
DACH2-007