ATP6V1F

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048700

 

Antibody CAB009529

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA048700 sc-20947 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

35  

Antigen sequence

DTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFL
 
 

Matching transcripts

ATP6V1F-002 - ENSP00000417378 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:100 

Validation IH

 Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

16.4 16.4, 13.4 

Antibody dilution

1:900 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleoli.
More information
  

Antibody dilution

1:182  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:30000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ATP6V1F-002