PODXL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002110

 

Antibody HPA045507

 

Antibody CAB016169

 

Antibody CAB062558

 

Antibody CAB068219

 

Antibody CAB068220

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Atlas Antibodies
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA002110 HPA045507 sc-23903 AMAb90667 AMAb90643 AMAb90644 

Host species

Rabbit Rabbit Mouse Mouse Mouse Mouse 

Clonality

pAb pAb mAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G Protein A/G 

Released in version

4 10 4 12 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

138 142     

Antigen sequence

LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVL
NLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVV
VKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
 
QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKAT
TLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADT
TTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTST
 
 
 
 
 

Matching transcripts

PODXL-001 - ENSP00000319782 [100%]
PODXL-005 - ENSP00000367817 [100%]
PODXL-202 - ENSP00000440518 [100%]
PODXL-201 - ENSP00000442655 [87%]
 PODXL-001 - ENSP00000319782 [100%]
PODXL-003 - ENSP00000390152 [100%]
PODXL-005 - ENSP00000367817 [100%]
PODXL-201 - ENSP00000442655 [100%]
PODXL-202 - ENSP00000440518 [99%]
     

Other gene match

      

ANTIBODY VALIDATION

         Immunohistochemistry

Image

      

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows moderate membranous positivity in renal glomeruli.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic positivity in glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:125 1:300 1:250 1:2000 1:5000 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

      

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli, plasma membrane, vesicles & microtubule organizing center.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:87 1:7 1:75    

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Non-supportive: The subcellular location is not consistent with literature. Non-supportive: The subcellular location is not consistent with literature.    

         Western Blot

Image

      

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401657)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.9, 58.6, 55.4, 55.3 58.9, 58.6, 55.4, 55.3, 32.7 58.9, 58.6, 55.4, 55.3, 32.7 58.9, 58.6, 55.4, 55.3, 32.7 58.9, 58.6, 55.4, 55.3, 32.7 58.9, 58.6, 55.4, 55.3, 32.7 

Antibody dilution

1:250 1:250 1:500 1:500 1:1000 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

      

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:500     

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.     
 

ANTIGEN VIEW

? »
 
 
 
PODXL-001
 
PODXL-003
 
PODXL-005
 
PODXL-201
 
PODXL-202