FOXP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000382

 

Antibody HPA000383

 

Antibody CAB011488

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA000382 HPA000383 ab16046 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

104 104  

Antigen sequence

AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGL
SPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPI
THHS
 
SLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLD
HIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELE
DDRE
 
 

Matching transcripts

FOXP2-001 - ENSP00000265436 [100%]
FOXP2-004 - ENSP00000386200 [100%]
FOXP2-005 - ENSP00000377135 [100%]
FOXP2-010 - ENSP00000367482 [100%]
FOXP2-014 - ENSP00000377132 [100%]
FOXP2-016 - ENSP00000375084 [100%]
FOXP2-017 - ENSP00000353367 [100%]
FOXP2-018 - ENSP00000377133 [100%]
FOXP2-020 - ENSP00000377129 [100%]
FOXP2-201 - ENSP00000377130 [100%]
FOXP2-202 - ENSP00000377137 [100%]
FOXP2-203 - ENSP00000385069 [100%]
 FOXP2-001 - ENSP00000265436 [100%]
FOXP2-004 - ENSP00000386200 [100%]
FOXP2-005 - ENSP00000377135 [100%]
FOXP2-014 - ENSP00000377132 [100%]
FOXP2-020 - ENSP00000377129 [100%]
FOXP2-201 - ENSP00000377130 [100%]
FOXP2-203 - ENSP00000385069 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human esophagus shows distinct nuclear positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:25 1:600 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

82.6, 81.8, 79.9, 77.2, 70.1, 59.9, 51.3, 48.8, 43.9, 41.0, 18.5 82.6, 81.8, 79.9, 77.2, 70.1, 59.9 82.6, 81.8, 79.9, 77.2, 70.1, 59.9, 51.3, 48.8, 43.9, 41.0, 23.7, 18.5, 9.4, 8.7, 7.2 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1000 1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
FOXP2-001
 
FOXP2-004
 
FOXP2-005
 
FOXP2-010
 
FOXP2-014
 
FOXP2-016
 
FOXP2-017
 
FOXP2-018
 
FOXP2-020
 
FOXP2-201
 
FOXP2-202
 
FOXP2-203
 
 »