CDO1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036573

 

Antibody HPA057503

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036573 HPA057503 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

84 96 

Antigen sequence

ILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGN
GKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGN
 
LKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPA
VSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSL
 

Matching transcripts

CDO1-001 - ENSP00000250535 [100%]
 CDO1-001 - ENSP00000250535 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:200  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419737)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419737)
More information
 

Target mass (kDa)

23.0 23.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
CDO1-001