PPAN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014232

 

Antibody HPA043265

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA014232 HPA043265 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

106 40 

Antigen sequence

VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHP
LLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQ
SRELSQ
 
RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
 

Matching transcripts

PPAN-201 - ENSP00000450710 [100%]
 PPAN-001 - ENSP00000253107 [100%]
PPAN-002 - ENSP00000377382 [100%]
PPAN-009 - ENSP00000415467 [100%]
 

Other gene match

PPAN-P2RY11 - ENSG00000243207 [100%]
P2RY11 - ENSG00000244165 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human oral mucosa shows strong nucleolar positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:250 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & centrosome.
More information
  

Antibody dilution

1:105  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

87.9, 40.3 53.2, 47.1, 23.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
PPAN-001
 
PPAN-002
 
PPAN-009
 
PPAN-201