ATP6V1E1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029196

 

Antibody CAB009528

 

Antibody CAB018699

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA029196 sc-20946 sc-48375 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

10 4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Not known 

Length (aa)

165   

Antigen sequence

KEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDT
TRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIAT
KNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMP
EVRGALFGANANRKF
 
 
 

Matching transcripts

ATP6V1E1-001 - ENSP00000253413 [100%]
ATP6V1E1-005 - ENSP00000382696 [100%]
ATP6V1E1-004 - ENSP00000398932 [87%]
ATP6V1E1-006 - ENSP00000382694 [82%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong membranous, cytoplasmic and extra cellular positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human pancreas shows strong positivity in islet cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:900 1:125 1:250 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

26.1, 23.6, 23.5, 22.7 26.1, 23.6, 23.5, 22.7 26.1, 23.6, 23.5, 22.7 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
   

Antibody dilution

1:29   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ATP6V1E1-001
 
ATP6V1E1-004
 
ATP6V1E1-005
 
ATP6V1E1-006