IDO1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023072

 

Antibody HPA023149

 

Antibody HPA027772

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023072 HPA023149 HPA027772 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

103 83 97 

Antigen sequence

MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLI
ESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVR
KVL
 
LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILI
PASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK
 
LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDP
KEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAH
 

Matching transcripts

IDO1-001 - ENSP00000430950 [100%]
IDO1-002 - ENSP00000253513 [100%]
IDO1-005 - ENSP00000430505 [100%]
IDO1-008 - ENSP00000428716 [100%]
 IDO1-001 - ENSP00000430950 [100%]
IDO1-005 - ENSP00000430505 [100%]
 IDO1-001 - ENSP00000430950 [100%]
IDO1-005 - ENSP00000430505 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows distinct cytoplasmic and nuclear positivity in cells outside the reaction centra.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human lymph node shows strong positivity in subsets of cells outside the germinal center.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:150 1:500 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in microtubules.
More information
 

Antibody dilution

1:100 1:50 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400784)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400784)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400784)
More information
 

Target mass (kDa)

45.3, 20.6, 20.0 45.3 45.3 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:100000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
IDO1-001
 
IDO1-002
 
IDO1-005
 
IDO1-008