CA6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028550

 

Antibody HPA028692

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028550 HPA028692 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

72 97 

Antigen sequence

PPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNH
RVVESNFPNQEYTLGSEFQFYL
 
SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEV
KNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY
 

Matching transcripts

CA6-001 - ENSP00000366662 [100%]
CA6-006 - ENSP00000366661 [100%]
CA6-005 - ENSP00000366654 [83%]
 CA6-001 - ENSP00000366662 [100%]
CA6-005 - ENSP00000366654 [100%]
CA6-006 - ENSP00000366661 [100%]
CA6-007 - ENSP00000447108 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human salivary gland shows strong cytoplasmic and extra cellular positivity in glandular cells.
More information
 Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:7 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-251MG shows no positivity.
More information
 

Antibody dilution

1:20 1:10 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420071)
More information
  

Target mass (kDa)

35.4, 28.7 35.4, 28.7, 21.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CA6-001
 
CA6-005
 
CA6-006
 
CA6-007