VIMP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010025

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA010025 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

110 

Antigen sequence

EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWD
SMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEG
GGACSWRPGR
 

Matching transcripts

VIMP-001 - ENSP00000381282 [100%]
VIMP-002 - ENSP00000433541 [100%]
VIMP-005 - ENSP00000433803 [100%]
VIMP-201 - ENSP00000437381 [100%]
VIMP-006 - ENSP00000434842 [98%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in endoplasmic reticulum.
More information
 

Antibody dilution

1:105 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

23.8, 21.2, 21.0, 18.5 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
VIMP-001
 
VIMP-002
 
VIMP-005
 
VIMP-006
 
VIMP-201