CASP9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001473

 

Antibody HPA046488

 

Antibody CAB004348

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA001473 HPA046488 sc-17784 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 13 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

132 107  

Antigen sequence

ALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKL
RRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSC
 
SPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGF
VSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMP
GCFNFLR
 
 

Matching transcripts

CASP9-001 - ENSP00000330237 [100%]
CASP9-003 - ENSP00000396540 [100%]
CASP9-008 - ENSP00000365051 [100%]
CASP9-009 - ENSP00000449584 [100%]
CASP9-007 - ENSP00000408691 [86%]
 CASP9-001 - ENSP00000330237 [100%]
CASP9-002 - ENSP00000255256 [100%]
CASP9-008 - ENSP00000365051 [100%]
CASP9-009 - ENSP00000449584 [83%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human rectum shows cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows distinct cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:150 1:600 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:6   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.5, 46.3, 36.6, 28.8, 21.8 46.5, 46.3, 36.6, 30.2 46.5, 46.3, 36.6, 30.2, 28.8, 28.4, 21.8, 17.0, 11.1 

Antibody dilution

1:250 1:270 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:2150  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CASP9-001
 
CASP9-002
 
CASP9-003
 
CASP9-007
 
CASP9-008
 
CASP9-009