MYH11

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014539

 

Antibody HPA015310

 

Antibody CAB002302

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA014539 HPA015310 NCL-MHC-Sm 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

88 97  

Antigen sequence

LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQL
SDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK
 
VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKN
KQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
 
 

Matching transcripts

MYH11-001 - ENSP00000300036 [100%]
MYH11-003 - ENSP00000458731 [100%]
MYH11-006 - ENSP00000379616 [100%]
MYH11-013 - ENSP00000407821 [100%]
MYH11-201 - ENSP00000345136 [100%]
 MYH11-001 - ENSP00000300036 [100%]
MYH11-003 - ENSP00000458731 [100%]
MYH11-006 - ENSP00000379616 [100%]
MYH11-013 - ENSP00000407821 [100%]
MYH11-201 - ENSP00000345136 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human breast shows moderate positivity in myoepithelial cells.
More information
 Immunohistochemical staining of human breast shows strong positivity in myoepithelial cells.
More information
 Immunohistochemical staining of human rectum shows distinct positivity in smooth muscle of vessels.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:125 1:100 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nuclei.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:25 1:34 1:13 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

228.1, 227.3, 224.3, 223.6 228.1, 227.3, 224.3, 223.6 228.1, 227.3, 224.3, 223.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MYH11-001
 
MYH11-003
 
MYH11-006
 
MYH11-013
 
MYH11-201