TRPM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014785

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA014785 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

119 

Antigen sequence

VGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEH
KEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSL
RSKSLHGHPRNVKSIQGKL
 

Matching transcripts

TRPM1-001 - ENSP00000380897 [100%]
TRPM1-004 - ENSP00000256552 [100%]
TRPM1-007 - ENSP00000453119 [100%]
TRPM1-201 - ENSP00000437849 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in melanocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not consistent with RNA expression data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:51 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

186.5, 184.8, 182.2, 173.6 

Antibody dilution

1:250 

Validation WB

Current setup is not applicable due to low RNA count 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TRPM1-001
 
TRPM1-004
 
TRPM1-007
 
TRPM1-201