APC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013349

 

Antibody CAB025994

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA013349 AF3695 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

125  

Antigen sequence

DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQ
RQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRV
GSNHGINQNVSQSLCQEDDYEDDKP
 
 

Matching transcripts

APC-001 - ENSP00000257430 [100%]
APC-002 - ENSP00000423224 [100%]
APC-004 - ENSP00000427089 [100%]
APC-005 - ENSP00000423828 [100%]
APC-201 - ENSP00000413133 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human nasopharynx shows strong membranous positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:10 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
  

Antibody dilution

1:167  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

  

Target mass (kDa)

311.6, 145.8, 126.2 311.6, 145.8, 126.2, 32.8, 29.7, 13.0 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
APC-001
 
APC-002
 
APC-004
 
APC-005
 
APC-201