BIN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003894

 

Antibody HPA005437

 

Antibody CAB001945

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA003894 HPA005437 05-449 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 3 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

106 148  

Antigen sequence

SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTD
ELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPEN
FTERVP
 
VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEG
TRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENND
LLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH
 
 

Matching transcripts

BIN1-001 - ENSP00000316779 [100%]
BIN1-002 - ENSP00000350654 [100%]
BIN1-003 - ENSP00000315388 [100%]
BIN1-004 - ENSP00000259238 [100%]
BIN1-005 - ENSP00000315411 [100%]
BIN1-006 - ENSP00000376760 [100%]
BIN1-007 - ENSP00000376761 [100%]
BIN1-008 - ENSP00000315284 [100%]
BIN1-010 - ENSP00000259237 [100%]
BIN1-011 - ENSP00000386797 [100%]
BIN1-012 - ENSP00000365281 [100%]
 BIN1-001 - ENSP00000316779 [100%]
BIN1-002 - ENSP00000350654 [100%]
BIN1-003 - ENSP00000315388 [100%]
BIN1-004 - ENSP00000259238 [100%]
BIN1-005 - ENSP00000315411 [100%]
BIN1-006 - ENSP00000376760 [100%]
BIN1-007 - ENSP00000376761 [100%]
BIN1-008 - ENSP00000315284 [100%]
BIN1-010 - ENSP00000259237 [100%]
BIN1-011 - ENSP00000386797 [100%]
BIN1-012 - ENSP00000365281 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells and glial cells.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:350 1:35 1:600 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403388)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403388)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.7, 59.9, 56.5, 55.2, 54.9, 53.0, 51.7, 50.2, 48.3, 47.5, 45.6 64.7, 59.9, 56.5, 55.2, 54.9, 53.0, 51.7, 50.2, 48.3, 47.5, 45.6 64.7, 59.9, 56.5, 55.2, 54.9, 53.0, 51.7, 50.2, 48.3, 47.5, 45.6 

Antibody dilution

1:125 1:125 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
   

Antibody dilution

1:38   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
BIN1-001
 
BIN1-002
 
BIN1-003
 
BIN1-004
 
BIN1-005
 
BIN1-006
 
BIN1-007
 
BIN1-008
 
BIN1-010
 
BIN1-011
 
BIN1-012
 
 »