IDH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035248

 

Antibody HPA057936

 

Antibody CAB033218

 

Antibody CAB062556

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Atlas Antibodies
 

Product name

HPA035248 HPA057936 sc-49996 AMAb90578 

Host species

Rabbit Rabbit Goat Mouse 

Clonality

pAb pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

6 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

65 73   

Antigen sequence

FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFA
HSSFQMALSKGWPLY
 
LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRS
DYLNTFEFMDKLGENLKIKLAQA
 
 
 

Matching transcripts

IDH1-001 - ENSP00000260985 [100%]
IDH1-004 - ENSP00000410513 [100%]
IDH1-006 - ENSP00000390265 [100%]
 IDH1-001 - ENSP00000260985 [100%]
IDH1-004 - ENSP00000410513 [100%]
IDH1-006 - ENSP00000390265 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows moderate nuclear, cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:250 1:75 1:10000 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.7 46.7 46.7, 17.7, 8.3, 7.1 46.7, 17.7, 8.3, 7.1 

Antibody dilution

1:250 1:160 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500 1:1900   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
IDH1-001
 
IDH1-004
 
IDH1-006