BRCA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026815

 

Antibody HPA056112

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA026815 HPA056112 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

131 115 

Antigen sequence

VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGT
FVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDET
DLLFTDQHNICLKLSGQFMKEGNTQIKEDLS
 
VPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHATHS
LFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQEK
SLKASKSTPDGTIKD
 

Matching transcripts

BRCA2-001 - ENSP00000369497 [100%]
BRCA2-201 - ENSP00000439902 [100%]
 BRCA2-001 - ENSP00000369497 [100%]
BRCA2-201 - ENSP00000439902 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:275  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:100 1:79 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

Target mass (kDa)

384.2 384.2 

Antibody dilution

  

Validation WB

  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3200 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
BRCA2-001
 
BRCA2-201