BRD4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015055

 

Antibody HPA061646

 

Antibody CAB068177

 

Antibody CAB068178

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA015055 HPA061646 AMAb90841 AMAb90843 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

4 13 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

142 78   

Antigen sequence

PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLR
PEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
 
PPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHST
PPHLNQHAVVSPPALHNALPQQPSRPSN
 
 
 

Matching transcripts

BRD4-001 - ENSP00000263377 [100%]
 BRD4-001 - ENSP00000263377 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
More information
 Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:250 1:250 1:250 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line PC-3 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:26 1:112   

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.   

         Western Blot

Image

    

Description

  Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

152.2 152.2 152.2, 88.3, 80.5, 63.8, 16.9, 11.7 152.2, 88.3, 80.5, 63.8, 16.9, 11.7 

Antibody dilution

1:250 1:370 1:1000 1:1000 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:4500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
BRD4-001