EGFR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001200

 

Antibody HPA018530

 

Antibody CAB000035

 

Antibody CAB068186

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 Atlas Antibodies
 

Product name

HPA001200 HPA018530 28-0005 AMAb90816 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

3 4 1 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein 

Length (aa)

149 149   

Antigen sequence

EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELD
ILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSL
NITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
 
QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRY
SSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAP
SRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD
 
 
 

Matching transcripts

EGFR-001 - ENSP00000275493 [100%]
EGFR-002 - ENSP00000345973 [100%]
EGFR-003 - ENSP00000342376 [100%]
EGFR-004 - ENSP00000415559 [100%]
EGFR-201 - ENSP00000410031 [100%]
EGFR-202 - ENSP00000395243 [100%]
 EGFR-001 - ENSP00000275493 [100%]
EGFR-202 - ENSP00000395243 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic and membranous positivity in epidermal cells.
More information
 Immunohistochemical staining of human placenta shows distinct membranous positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 Proteinase K. HIER pH6 

Antibody dilution

1:50 1:100 1:40 1:2000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Not done Not done Mainly consistent with RNAseq data 

         Immunofluorescence

Image

    

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

 1:56 1:10  

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

134.3, 128.7, 120.7, 77.3, 72.4, 69.2 134.3, 128.7 134.3, 128.7, 120.7, 77.3, 72.4, 69.2, 44.7, 14.7 134.3, 128.7, 120.7, 77.3, 72.4, 69.2, 44.7, 14.7 

Antibody dilution

1:250 1:250 1:400 1:1000 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
EGFR-001
 
EGFR-002
 
EGFR-003
 
EGFR-004
 
EGFR-201
 
EGFR-202