RPL10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011311

 

Antibody CAB010339

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA011311 sc-798 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

110  

Antigen sequence

KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIE
ALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI
PSRGPLDKWW
 
 

Matching transcripts

RPL10-001 - ENSP00000341730 [97%]
RPL10-008 - ENSP00000358832 [97%]
RPL10-011 - ENSP00000385621 [97%]
RPL10-201 - ENSP00000413436 [97%]
RPL10-015 - ENSP00000388600 [91%]
  

Other gene match

RPL10L - ENSG00000165496 [94%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:150 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

24.6, 24.5, 23.1, 18.6 24.6, 23.1, 20.2, 18.6, 14.6, 12.3, 10.0, 3.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:10  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
RPL10-001
 
RPL10-008
 
RPL10-011
 
RPL10-015
 
RPL10-201